PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C011156P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 999aa    MW: 111507 Da    PI: 5.5311
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C011156P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.12e-183884148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g WT+eEde+l +av+++ g++Wk+Ia+++   Rt+ qc +rwqk+l
   MELO3C011156P1 38 KGQWTAEEDEILRKAVQRFKGKNWKKIAECFK-DRTDVQCLHRWQKVL 84
                     799****************************9.************986 PP

2Myb_DNA-binding66.64.4e-2190136148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+W++eEde++v++v+++G++ W+tIa++++ gR +kqc++rw+++l
   MELO3C011156P1  90 KGPWSKEEDEIIVELVEKYGPKKWSTIAQHLP-GRIGKQCRERWHNHL 136
                      79******************************.*************97 PP

3Myb_DNA-binding48.71.8e-15142184145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      + +WT+eE++ l++a++ +G++ W+   + ++ gRt++ +k++w+
   MELO3C011156P1 142 KEAWTQEEELALIRAHQIYGNR-WAELTKFLP-GRTDNAIKNHWN 184
                      579*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.0153384IPR017930Myb domain
SuperFamilySSF466898.61E-163490IPR009057Homeodomain-like
SMARTSM007172.2E-153786IPR001005SANT/Myb domain
PfamPF002498.4E-163884IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.9E-223991IPR009057Homeodomain-like
CDDcd001673.43E-144184No hitNo description
PROSITE profilePS5129433.85685140IPR017930Myb domain
SuperFamilySSF466894.87E-3287183IPR009057Homeodomain-like
SMARTSM007178.5E-2089138IPR001005SANT/Myb domain
PfamPF002493.0E-1990136IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-2892140IPR009057Homeodomain-like
CDDcd001671.99E-1792136No hitNo description
PROSITE profilePS5129419.563141191IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.9E-21141191IPR009057Homeodomain-like
SMARTSM007172.2E-15141189IPR001005SANT/Myb domain
PfamPF002491.7E-13142185IPR001005SANT/Myb domain
CDDcd001674.52E-12144184No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
GO:0003713Molecular Functiontranscription coactivator activity
Sequence ? help Back to Top
Protein Sequence    Length: 999 aa     Download sequence    Send to blast
MESDPPLCTS LDVSGDSGQN IRALHSRRTT GPTRRSTKGQ WTAEEDEILR KAVQRFKGKN  60
WKKIAECFKD RTDVQCLHRW QKVLNPELVK GPWSKEEDEI IVELVEKYGP KKWSTIAQHL  120
PGRIGKQCRE RWHNHLNPAI NKEAWTQEEE LALIRAHQIY GNRWAELTKF LPGRTDNAIK  180
NHWNSSVKKK LDSYLASGLL EQYQPLHHAA QSSLPMLSSS RVQSSMDDSS LRGAETEDIS  240
EVSQTSAIGA CSNTIPRTKE ECQLAEDAFL KDEPCSPPHC PGQYHASLDN ITFSIPEMLS  300
ELGCYVKPPN HNFSQDCRTS STEDNQYNLY ELPNISSLEL GQELSHFQAN GSQEVENAPH  360
QTSAGLSAST AENLVTASVK PEHMLISDYE CCTVLFSDAI VNESFPSENT TDTPDMVELS  420
GYAHPLHRHT SIEMPESNRN LPLQSYHHER SDVLDNSCSQ RFLAPLLVSA NDDTYVYTSD  480
TSHLFETLEQ ELVANGRDVF IYTNESTDSP PKNGFKNAEL QKQQGSKDPS KLVPVNTFSS  540
EPKTAESLPS FSGRENTHSD QSDLIGALCY EPPRFPSLDV PFLSCDLAPA ASDMQQEYSP  600
LGIRQLMMSS MNCLTPFRLW NSPTRDESPD ALLKSAAKTF TNTPSILKKR HREFLSPLSD  660
KRCDKKQEID VGISRTPSHT NPSQHTVSTR SSEDKENICP TEEVRQEKHS DLYNISHRKR  720
PETTSDSCSF LENKLQELDN PATTDRIDSI GQIEVQQRSR ILLECDTNES LSYSTNHVGV  780
TEMQCSRTST ALQDQDFPSN LSDDHCALAN CSIASGTSHG RTLEVAGDNA SKESSLETIT  840
IFGGTPFKRS IESPSAWKSP WFINSFLFGP RMDTDVPMEE VGYFMSPGDR SYDAIGLMKE  900
VSEQTAAACA SAQEVLGNET PQSLLKGRRS KYENHHKDKK NHFTNSRSTL APDILTERRT  960
LDFSECGTPG KGTENGKSST ATTRSFSSPS SYLLKGCR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C2e-69381916159MYB PROTO-ONCOGENE PROTEIN
1h89_C2e-69381916159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00466DAPTransfer from AT4G32730Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818230.0LN681823.1 Cucumis melo genomic scaffold, anchoredscaffold00014.
GenBankLN7132570.0LN713257.1 Cucumis melo genomic chromosome, chr_3.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008445034.10.0PREDICTED: myb-related protein 3R-1
SwissprotQ9S7G70.0MB3R1_ARATH; Myb-related protein 3R-1
TrEMBLA0A0A0LLZ90.0A0A0A0LLZ9_CUCSA; Uncharacterized protein
STRINGPOPTR_0006s25840.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF37273362
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32730.20.0Homeodomain-like protein